SKU: 32472010974

MDL-1/CLEC5A His Tag Protein, Mouse

Sale price$315.00 Regular price$350.00
Save 10%

Pay in installments of $87.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MDL-1/CLEC5A His Tag Protein, MouseProduct Specification Species Mouse Accession Q9R007 Amino Acid Sequence Tyr26 Lys190, with N terminal 9*His HHHHHHHHHDDDDKYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK Expression System HEK293 Molecular Weight 27 35kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Mouse
Accession Q9R007
Amino Acid Sequence

Tyr26-Lys190, with N-terminal 9*His HHHHHHHHHDDDDKYFPQVFGKSNDGFVPTESYGTTSVQNVSQIFGRNDESTMPTRSYGTVCPRNWDFHQGKCFFFSFSESPWKDSMDYCATQGSTLAIVNTPEKLKYLQDIAGIENYFIGLVRQPGEKKWRWINNSVFNGNVTNQDQNFDCVTIGLTKTYDAASCEVSYRWICEMNAK

Expression System HEK293
Molecular Weight

27-35kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

CLEC5A is a spleen tyrosine kinase (Syk)-coupled C-type lectin that is highly expressed by monocytes, macrophages, neutrophils, and dendritic cells and interacts with virions directly, via terminal fucose and mannose moieties of viral glycans. CLEC5A also binds to N-acetyl glucosamine (GlcNAc) and N-acetylmuramic acid (MurNAc) disaccharides of bacterial cell walls. Compared to other C-type lectins (DC-SIGN and DC-SIGNR) and TLRs, CLEC5A binds its ligands with relatively low affinities. However, CLEC5A forms a multivalent hetero-complex with DC-SIGN and other C-type lectins upon engagement with ligands, and thereby mediates microbe-induced inflammatory responses via activation of Syk. For example, in vivo studies in mouse models have demonstrated that CLEC5A is responsible for flaviviruses-induced hemorrhagic shock and neuroinflammation, and a CLEC5A polymorphism in humans is associated with disease severity following infection with dengue virus. In addition, CLEC5A is co-activated with TLR2 by Listeria and Staphylococcus. Furthermore, CLEC5A-postive myeloid cells are responsible for Concanavilin A-induced aseptic inflammatory reactions. Thus, CLEC5A is apromis-Cuous pattern recognition receptor in myeloid cells and is a potential therapeutic target for attenuation of both septic and aseptic inflammatory reactions.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 32472010974

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
Ismara
Alexandria, US
★★★★★ 5
The best vacuum cleaner ever!!
Size: E25 Black, Size: E25 Black
⭐⭐⭐⭐⭐ I honestly couldn’t be happier with the Eufy E25. I actually own two of them, and they’ve completely changed my daily routine. After spending a lot of money trying different brands, I finally found one that truly delivers everything I need in a vacuum. The suction power is impressive, it handles pet hair and debris effortlessly, and the mopping feature actually works (not just a light wipe like others I’ve tried). The self-emptying and self-cleaning system is a game changer—it saves so much time and maintenance. Navigation is smart and reliable, and it rarely gets stuck. It covers my floors efficiently and leaves everything noticeably cleaner. I also love how low-maintenance it is overall. If you’re tired of wasting money on vacuums that don’t live up to expectations, this is absolutely worth it. For me, it has truly been life-changing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 10, 2026
I
Verified Purchase
itsmeray
Belleville, US
★★★★★ 3
Updated 1/28/2020 update 1/17/2020 It's been everything it was advertised to be and more. (Not)
Size: 11S
I called Amazon again today. Explained the situation and that no one from Amazon or Eufy had returned my calls as they promised. Also after replacing the battery at my own expense it ran 90 minutes again but got stuck everywhere, made this weird ratcheting type noise every time it changed surfaces and finally today just beeped at me twice and died. Supposedly that indicates a seized brush but they all spin freely. This time I just flat out asked them to look at my Amazon account and replace it, as I'm a very good customer. New one will be here tomorrow. I'll do a separate review on that one as it took me forever to find this one again. I'll also let you know if it's a refurbished unit or not. Well wouldn't you know it. I leave a nice review and a few days later, Murphy's law rears it's ugly head. Device is 3 months old a couple weeks out of the exchange warranty and the battery is shot. Runs 5 or 10 minutes on a full charge. Called Amazon to see if since I am a really long standing customer if they'd help me out. Nope but we'll call Eufy support on your behalf and they will call you. We will also call you to follow up. I've been a customer service manager a lot of years and this is where employees can kill you. This Amazon person made me multiple promises. It's been a week no call from Eufy, no call from Amazon. You just turned 4 stars into 1 and if this is all the longer the batter lasts don't bother because the replacements are $25 to $30 bucks depending on the brand. I'm not spending a hundred bucks a year on batteries and this thing should be under warranty. After 3 days I ordered a new battery and Rosie is running again but I'm no longer pleased and the next time I'll buy another brand. If if this battery doesn't last the whole thing goes in the trash and I buy something else. I run this every day maybe the batteries won't take that I don't know. But if you're going to run it every day buy something else. This didn't last long enough at all. I wanted to wait a while to be sure I had a good sampling and could post a fair and useful review. It's been 90 days now. We have two large (bigger than standard) labradoodle puppies. 85 and 50 pounds and they're 1st generation so they shed a lot. They also, being puppies, have tore the yard up so it is basically a mud pit and they wrestle, run, and fight constantly. They put a lot of dirt and hair on the floors and in the air. We run "Rosie" every day. Yes my wife named it. It does an amazing job on our hardwood floors and throw rugs. It gets all the hair and an incredible amount of dust and dirt. What I mean by that is we can run our Dyson or the Shark Pet vacuum and then run Rosie and the chamber will be full of dust and dirt when she's done. It's almost disconcerting to know our very expensive upright vacuums leave so much behind. It also has the unadvertised ability to buff our hardwood floors. They shine when she's done and the beater brush is showing no signs of damaging the finish on our floors. I would disagree with some of the reviews and even the manufacturers assertion that it doesn't work well on dark floors. Our hardwood floors are a dark reddish brown. The device works great on them and as I said when it's finished they shine. We have agreed we will never be without one and love this device. It does everything it has been advertised to do and more. Also it is set to automatic power and runs longer than the advertised time on a full charge. We get about 2 hours and 15 minutes. We've put down an additional 6 throw rugs for the rainy snow season in the path where the dogs run when they come in and the time has dropped to around 90 to 100 minutes. Still long enough to cover everything well and more than once. It does keep going until it needs a charge it doesn't just run and go back to the dock. I've noticed in the open areas like our living room it might hit that 2 or even 3 times. The floors are like glass after that. Now for the negatives, and these are not deal breakers I'm just being fair. The dirt and dust I referred to is new to us. we recently moved from Illinois to Ohio. In Illinois the dirt is black. Here it is red or a very light brown. The vacuum gets externally dirty. It gets covered with dust/dirt and does not look good. The device is black and the dust is light colored and is readily apparent. I don't want to put it away all the time or for company so thats a problem for me and more cleaning which is not advertised so I'm mentioning it. Secondly it needs to be emptied every use or every other use. They are all like that except some of the super expensive robot vacuums so I wouldn't mention it except for my third negative. It is hard to clean from a mess standpoint. Not so much with the pet hair but with the dust. When you dump it the dust goes everywhere. Unless you have an empty trash can so you can get it way down inside when you're done the garbage can lid and sometimes the floor around the garbage can is clearly dusty from emptying the vacuum. The filters need to be removed at least every other running and they are also a big dusty mess. I also don't believe they will last as long as advertised. I have an air compressor in the garage and a hand held electric air compressor and use those to clean the filter. The foam piece I rinse in the sink. I don't think that someone without access to those tools is going to get the life out of the filters thats advertised. The device comes with a set of replacement filters and the rotating brushes. Not the beater bush though. Our unit is 3 months old. I had to replace the filters at about 40 days and tried to make them last a little longer this time but it hasn't worked out. The outside of the device is filthy. I believe this is due to the filters. The brushes have lasted longer than the suggested replacement time. They are 90 days old and still look like new. Last and has been a rare negative. The device will get stuck under things. Once I learned what the obstacles were in our home it was easy to fix. Some areas I blocked with rolled up moving blankets. I pull the chairs out from under the kitchen table to allow room for it to maneuver. If I don't it gets under there and spends way too much time cleaning and trying to get out. I'd rather it spend less time under there so it can do the whole cleaning area and have power left to do it again. I had the problem spots corrected and figured out within the first 30 days. I've read some units have a tape or something the vacuum will sense and avoid. I wish this unit had that but then again at this price point that is probably an unfair expectation. So those are the pro's and con's we've encountered. The con's are all minor irritants and not a reason not to buy the device as all of these devices are prone to these issues except one or two of the very very expensive units. To repeat what I said earlier this device has worked out so well we have decided that we will never be without one and that when the time comes to replace her we will not feel bad about spending the money for a high dollar unit as it is worth it. Time is worth more to us than money and this thing saves us a great deal of time. It does great job, has done no damage to anything, and if it weren't for the clean up issues would be a five star review. I hope this helps someone make an informed decision and I hope you buy one. It's an amazing little machine, stands up to all the reviews, and truly is the best bang for your buck in robot vacuums.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 1, 2020
T
Verified Purchase
terry boots
Whiting, US
★★★★★ 5
Mustang1
The parts fit great no problem
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
P
PH
Belleville, US
★★★★★ 5
Good for routine maintenance
The Eufy is a huge time saver, but the one annoying thing is continuously needing parts to replace it. This is where this purchase comes in - these parts fit just like the original parts, and take just seconds to install. They seem to be just as durable and functional. The brushes sweep corners well, and the filters keep the machine quiet while still pulliing in all of the dust. It's a great value to buy several at a time since they need to be replaced on a regular basis. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
K
K.A.
Los Angeles, US
★★★★★ 5
Great set of parts for the C10
I have 3 dogs and 3 cats so my robot vacuums get run multiple times a day and need maintenance performed more frequently as a result, plus I go through a LOT of the bags. (Labradors… IYKYK.) These parts appeared identical to the originals and all fit perfectly into my vacuum. The filters and brushes were all excellent quality and the roller bar was possibly a little better than the original. The dust bags feel thinner than the original but I haven’t had any issues with them - they fit into the compartment properly and haven’t torn or broken open. It’s a good kit and I think a pretty good deal, I would definitely get it again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 16, 2026

recommand products