SKU: 90187707091

Canis lupus familiaris CD64, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Canis lupus familiaris CD64, His tagProduct Specification Species Canis lupus familiaris Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI Accession Q7YQJ5 Amino Acid Sequence Protein sequence (Q7YQJ5, Gln16 Pro288, with C 10*His)

Product Specification


Species Canis lupus familiaris
Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI
Accession Q7YQJ5
Amino Acid Sequence

Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90187707091

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Lucky1334
Massapequa, US
★★★★★ 5
Perfect fit for 2016 Corolla!
Fit's my 2016 Corolla perfect. Has a sturdy frame. Other name brand ones I have purchased before don't have the sturdy frame and squish up. This comes with tiny fragrant beads on the top part and has a light fresh scent when the air is on. Very happy so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 8, 2025
M
Verified Purchase
Mr Frosty
Fort Morgan, US
★★★★★ 5
Good fit, good value
Style: CF12436 Classic, Style: CF12436 Classic
Purchased this filter for my 2023 Outback. First off changing the cabin filter on this model Subaru is amazingly easy and can be done with no tools and no more then 5 minutes. Pictures posted show packaging, the paper "Blue" filter side, the "Black" charcoal side and the foam outer edge. The filter is well made and is very sturdy as the outer shell is plastic vs. other paper filters that are more flexible. Holding the filter in your hand and giving it a slite shake you can hear the activated charcoal within it. After installing the filter I had a few trips in the car, did I notice any difference in the air quality coming into the cabin....... no. But does this mean its not working? also no. What I can say is the filter fit snug and left no gaps, and with the plastic surroundings and foam in sure the filter will not be letting anything get by as it passes through the system. All and all this filter is well made and sturdy, and seems to be a good value with other paper only filters being about the same price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
B
Verified Purchase
bin
Whiting, US
★★★★★ 5
Perfect Fit and Great Quality
Style: CF12552 Classic
The thickness is just right and fits perfectly. Easy to install, good airflow, and the air feels much cleaner after replacing the old filter. Great value for the price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
S
Verified Purchase
Steph
Alexandria, US
★★★★★ 5
Easy to install
Style: CF10374 Classic
The frame is made of hard plastic (color black) which fits perfectly in the air cabin filter system of a Toyota Tacoma 2006 V6. It holds it's shap quite well. The carbon filter is able to be seen and works so far. The quality seems good and the thickness of the filter is well made with a foam outter film that makes it fit my Tacoma very well. I'm happy with it. The ease of installation is good and it is well worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026
K
Verified Purchase
Kindle Customer
Carnegie, US
★★★★★ 5
Filter quality and value
Style: CF11809 Classic
2nd time to purchase this item over a 5 year period. The filter has a rigid frame making last much longer than other paper filters. Perfect fit and worth the cost. Great job filtering cabin and neutralizing odors!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026

recommand products