SKU: 45246562839

MUC-1(116-173) Fc Chimera Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

MUC-1(116-173) Fc Chimera Protein, HumanProduct Specification Species Human Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15 3 Accession P15941 Amino Acid Sequence Ser116 Gly173, with C terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms Mucin1, MUC1, CD227, EMA, H23AG, KL6, MAM6, MUC1, ZD, PEM, PEMT, PUM, CA15-3
Accession P15941
Amino Acid Sequence Ser116-Gly173, with C-terminal Human IgG1 Fc SVVVQLTLAFREGTINVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 36-42kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Brayman M. et al. (2004) MUC1: a multifunctional cell surface component of reproductive tissue epithelia. Reprod Biol Endocrinol 2: 4.

2、Schroeder J A. et al. (2001) Transgenic MUC1 interacts with epidermal growth factor receptor and correlates with mitogen-activated protein kinase activation in the mouse mammary gland. J Biol Chem. 276(16): 13057-64.

3、Li Y. et al. (2001) The epidermal growth factor receptor regulates interaction of the human DF3/MUC1 carcinoma antigen with c-Src and beta-catenin. J Biol Chem. 276(38): 35239-42.

Background

Mucin 1, cell surface-associated (MUC1) or polymorphic epithelial mucin (PEM) is a membrane-bound protein that is a member of the mucin family. Mucins are heavily glycosylated proteins that give the mucosa viscous gel-forming properties, and contribute to the structural organization of secretory epithelia. The mucosa serves as a physical barrier to protect the epithelium from harsh environments such as low pH and microbial infections. Cell surface associated mucins, such as Mucin-1 (Muc-1), are important components of the mucosal barrier that exist at the interface of the apical surface between secreted mucins and the cell surface. In addition to the mucus-type functions of its extracellular mucin domain, Muc-1 is a transmembrane protein with a cytoplasmic tail that is a known target of multiple kinases that has been shown to participate in normal and oncogenic signaling.Muc-1 is overexpressed and aberrantly glycosylated in many cancers, where it has been documented to play an important role in inflammation and tumor progression.Muc-1 is also expressed on many non-epithelial cell types including leukocytes, where its function is less well characterized. It has been documented that Muc-1 controls inflammation resulting from Helicobacter pylori infection by suppressing activation of the NLRP3 inflammasome. Knockout of Muc-1 also results in aberrant expansion of myeloid derived suppressor cells from the bone marrow.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45246562839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Adri Warner
Belleville, US
★★★★★ 5
Bathroom counter organizer
I bought this to try and help keep our bathroom counter neat and tidy. It fits perfectly between our sinks and it hold all of the little bottles and other bathroom stuff. This is very sturdy, and doesn’t feel cheap at all. I am happy with my purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 7, 2024
L
Verified Purchase
Line Dancer
Massapequa, US
★★★★★ 5
A Place for Everything!!
Sleek looking organizer that holds ALL my stuff. Nice assortment of drawers and cubby holes to put things into. Cleared up the clutter and items are now easier to access! Love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 7, 2023
P
Verified Purchase
Pianojazzed
Charlottesville, US
★★★★★ 5
Spacious Storage
Color: White, Size: 2 Layer
Excellent quality and spacious storage. I bought this because I had a plastic makeup organizer. My husband complained about me making a racket when I am putting my makeup because the makeup tools makes a loud noise when I put them back in the plastic organizer. I thought I'll buy a leather one so it wouldn't be so noisy. It's magic. No more complains from my hubby. In addition, I was impressed with the quality of this organizer. Beautiful and plenty of storage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 17, 2026
K
Verified Purchase
Kathleen Novitsky
Dallas, US
★★★★★ 5
Love my Makeup Organizer!
Color: Beige, Size: 3 Layer
Very sturdy and attractive. Fits into space I needed. I plan on buying more products from this company.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
M
Verified Purchase
MarkyMark_87
Port Orchard, US
★★★★★ 5
Wife Says It’s a Total Game Changer for Organization
Color: Beige, Size: 3 Layer
Got this for my wife and she said it’s a total game changer. She loves it. It cleaned up her whole vanity setup and made everything way easier to find. There’s a ton of space, so all her makeup finally has a place instead of being spread out everywhere. She especially likes how organized it keeps everything while still looking clean and nice on the counter. Build quality feels solid and it looks more high-end than I expected. Not flimsy at all, which was a big plus. Overall, definitely worth it. If you’re trying to get things organized without it looking cluttered, this does the job really well. Solid husband points
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2026

recommand products