SKU: 22835555651

Human BCMA/TNFRSF17 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BCMA/TNFRSF17 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 17, B cell maturation protein, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Protein sequence (Q02223 1, Met1 Ala54, with C His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Expression System HEK293 Molecular Weight Predicted MW: 5. 9 kDa Observed MW: 10, 13 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression System HEK293
Molecular Weight Predicted MW: 5.9 kDa Observed MW: 10, 13 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22835555651

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
AnaC
Massapequa, US
★★★★★ 5
Great Quality and durability
Color: Ultra, Size: Large
I have a teething puppy and this is the only ball that has outlasted the rest!! Big chewer and still bounces and no tears! Keeps him entertained for hours!! Sturdy, solid, good quality and value!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
D
Verified Purchase
Dana Kurtz
Natrona Heights, US
★★★★★ 5
Durable, even for a Great Dane!
Color: Ultra, Size: XXL
I've bought many tennis ball sized ChuckIt balls in the past (for medium sized dogs we've owned), so when we knew we were going to be babysitting our daughter's Great Dane, I bought a bigger one for her. The 4" is perfect for her! She plays catch with it, but also likes to gnaw on it. It holds up great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
O
Verified Purchase
Ol' Hippie
Los Angeles, US
★★★★★ 5
Another great product from Chuckit!
Color: Ultra, Size: XL
Exactly the high quality that I've come to expect from Chuckit! The plastic/rubber used in their products is extremely tough yet gives enough that it's hard to actually pierce the it and tear apart. We have had Chuckit! Sticks and Balls with launcher for years and love them all. This particular ball is pretty big so my 45 pound pit mix struggles to pick it up but that's part of the fun for him. My 85 pound pit mix can pick it up no problem. The only "complaint" is that the two of them have been having so much fun with their new ball, they have already knocked something over and broke it. 😁
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 26, 2026
C
Verified Purchase
Cristy L. Spencer
Boise, US
★★★★★ 5
Perfect for my mid size pit bull
Color: Ultra, Size: XL
Updating my review, the ball only lasted 5 days. I left the 5 stars because we had enough fun those 5 days to be worth the small price. She has dog has a lot of jaw strength, so I’m not surprised We have a mid size foster pit bull. This ball is her favorite toy. It’s durable and the perfect size for her to play ball safely.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
C
Verified Purchase
cassidy y
Louisville, US
★★★★★ 5
Good quality
Color: Ultra, Size: Large, Color: Ultra, Size: Large
Great quality. I purchased for my daughter’s dog who destroys all toys. This toy holds up. I didn’t realize it was a large and the chickit stick she had was a medium. The large ball ended up working out good for playing inside the house. The dog likes it a lot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products