SKU: 1571584626

IL10RB Fc Chimera Protein, Human

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL10RB Fc Chimera Protein, HumanProduct Specification Species Human Synonyms CDw210B, CRF2 4, CRFB4, CRFB4, D21S58, D21S66, IBD25, IL 10R2 Accession Q08334 Amino Acid Sequence Met20 Ser220, with C terminal Human IgG Fc

Product Specification


Species Human
Synonyms CDw210B, CRF2-4, CRFB4, CRFB4, D21S58, D21S66, IBD25, IL-10R2
Accession Q08334
Amino Acid Sequence

Met20-Ser220, with C-terminal Human IgG Fc MVPPPENVRMNSVNFKNILQWESPAFAKGNLTFTAQYLSYRIFQDKCMNTTLTECDFSSLSKYGDHTLRVRAEFADEHSDWVNITFCPVDDTIIGPPGMQVEVLADSLHMRFLAPKIENEYETWTMKNVYNSWTYNVQYWKNGTDEKFQITPQYDFEVLRNLEPWTTYCVQVRGFLPDRNKAGEWSEPVCEQTTHDETVPSIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 60-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Lutfalla, G. et al. (1993) Genomics 16:366. 2. Xie, M.-H. et al. (2000) J. Biol. Chem. 275:31335. 3. Kotenko, S.V. et al. (2003) Nat. Immunol. 4:69. 4. Yoon, S.I. et al. (2006) J. Biol. Chem. 281:35088.

Background

Interleukin 10 receptor, beta subunit (IL10RB/IL-10RB) also known as Cytokine receptor family 2 member 4, Interleukin-10 receptor subunit 2, and cytokine receptor family II, member 4, is a subunit for the interleukin-10 receptor. Some members of the IL-10 family are monomeric cytokines and interact with single molecules of IL-10 R beta and their ligand‑specific subunit. Mature human IL-10 R beta consists of a 201 amino acid (aa) extracellular region with two fibronectin type-III domains, a 22 aa transmembrane segment and a 83 aa cytoplasmic domain. IL‑10 R beta is widely expressed, while the associated receptor subunits exhibit differential expression patterns. The ligand‑specific subunits are responsible for the divergent functions of these cytokines, encompassing immune suppression, promotion or inhibition of inflammation, mucosal defense, antiviral immunity, and hematopoiesis. IL-10 R beta deficient mice lack responsiveness to each of those cytokines. IL-10 R beta contributes to ligand binding, but effective signaling is only triggered in the presence of the ligand‑specific subunit. In the case of IL-10, a cytokine dimer binds to two IL‑10 R alpha /IL-10R1 chains, resulting in recruitment of two IL-10 R beta /IL-10R2 chains.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1571584626

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Aaron harkcom
Draper, US
★★★★★ 5
Great value and super convenient for everyday use!
Size: 300 Count
exactly what I needed for busy days and quick cleanups. They’re sturdy enough for everyday meals like sandwiches, snacks, and even lighter hot foods without getting soggy or falling apart. I love the convenience of having such a large pack on hand — it lasts a long time and is perfect for families, parties, or meal prep days. The size is just right for most meals, and they stack easily for storage. For the price and quantity, it’s a great deal and saves so much time on dishwashing. Definitely a household staple I keep restocking!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
B
Verified Purchase
Bre Asop
Natrona Heights, US
★★★★★ 5
𝗠𝘆 𝗚𝗼-𝗧𝗼 𝗳𝗼𝗿 𝗩𝗮𝗹𝘂𝗲 & 𝗩𝗲𝗿𝘀𝗮𝘁𝗶𝗹𝗶𝘁𝘆!
Size: 300 Count, Size: 300 Count
I use these plates for everything. You'd think their adhesive-like fit to one another would mean they're flimsy. But no! Once you nail the knack of separating them, you'll find them sturdy and versatile! I use them for everything, especially when I don't have time to do dishes! A typical day involves working outside, running in to grab lunch on one of these plates, then using the plate to keep parts together for whatever I'm working on. A magnet underneath does wonders, combined with the plate lip to keep small bits from flying everywhere! I also use them under potted plants. If water seeps through the pot, it doesn't leak through the plate. The size and shape are fit for a hearty meal. The tall lip is firm and keeps juices or sauces from sloshing over. The price is unbeatable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
G
Verified Purchase
Gabby L.
Omaha, US
★★★★★ 5
Great plates at a great price
Size: 200 Count
They are not heavy duty for a full plate out for simple foods and treats these are great. I have them on subscription and I get more fir the value compared to the stores near me. Perfect for pizza nights when u don't want to do the dishes!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
Z
Verified Purchase
Zuhair Family
New York, US
★★★★★ 5
Soft, Hydrating, and Long-Lasting Moisture – Great Everyday Body Wash
Scent: Fragranced, Size: 30.6 Fl Oz (Pack of 1)
I really like this Dove Body Wash Deep Moisture. It leaves my skin feeling super soft and hydrated, almost like I used lotion right after showering. The “24hr moisture” claim actually feels pretty accurate because my skin doesn’t dry out like it does with other body washes. It lathers nicely, smells clean and not too strong, and I also like that it’s made with no sulfates or parabens. The bottle is a good size (30.6 oz) so it lasts a while too. Overall, it’s a really solid everyday body wash and one of the best I’ve used for keeping my skin smooth and moisturized.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
G
Verified Purchase
Gabriel L. De Mattos
Omaha, US
★★★★★ 5
The body wash I reach for every time and my skin has never felt better
Scent: Fragranced, Size: 30.6 Fl Oz (Pack of 1)
I have been through a lot of body washes over the years and this Dove Deep Moisture is the one I keep coming back to. The texture is thick and creamy, a little goes a long way, and it rinses clean without leaving any heavy residue behind. After getting out of the shower my skin genuinely feels softer and not dry or tight the way it does with some other washes. The scent is pleasant and mild, something like a clean, soft powder rather than an artificial floral or chemical smell. It does not linger too long which I actually prefer since heavy fragrances can be irritating. The formula with no sulfates and no parabens makes it a gentler option and I have noticed fewer issues with dry patches since switching to it. The 30.6 oz size is great for the price and lasts a good while even with daily use. This is just a reliable, high quality everyday body wash that does exactly what it promises. Simple and effective.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 5, 2026

recommand products